CA10 Antibody - N-terminal region : FITC

CA10 Antibody - N-terminal region : FITC
SKU
AVIARP56294_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that belongs to the carbonic anhydrase family of zinc metalloenzymes, which catalyze the reversible hydration of carbon dioxide in various biological processes. The protein encoded by this gene is an acatalytic member of the alpha-carbonic anhydrase subgroup, and it is thought to play a role in the central nervous system, especially in brain development. Multiple transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human CA10

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: NISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: carbonic anhydrase-related protein 10

Protein Size: 253

Purification: Affinity Purified
More Information
SKU AVIARP56294_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56294_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56934
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×