CABCOCO1 Antibody - C-terminal region : Biotin

CABCOCO1 Antibody - C-terminal region : Biotin
SKU
AVIARP55638_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat RGD1306739

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: PLGGFTIDDVKLALARVTDEVLISIQNEINEKLQVQEESFNARIEKLKKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: uncharacterized protein C10orf107 homolog

Protein Size: 313

Purification: Affinity Purified
More Information
SKU AVIARP55638_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55638_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 361834
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×