CAMK1D Antibody - middle region : FITC

CAMK1D Antibody - middle region : FITC
SKU
AVIARP57405_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ca2+/calmodulin-dependent protein kinase 1 subfamily of serine/threonine kinases. The encoded protein may be involved in the regulation of granulocyte function through the chemokine signal transduction pathway. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAMK1D

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: KNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Calcium/calmodulin-dependent protein kinase type 1D

Protein Size: 385

Purification: Affinity Purified
More Information
SKU AVIARP57405_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57405_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57118
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×