CASS4 Antibody - N-terminal region : HRP

CASS4 Antibody - N-terminal region : HRP
SKU
AVIARP57390_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CASS4 is a docking protein that plays a role in tyrosine kinase-based signaling related to cell adhesion and cell spreading. It regulates PTK2/FAK1 activity, focal adhesion integrity, and cell spreading.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CASS4

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cas scaffolding protein family member 4

Protein Size: 349

Purification: Affinity Purified
More Information
SKU AVIARP57390_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57390_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57091
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×