CCDC190 Antibody - N-terminal region : Biotin

CCDC190 Antibody - N-terminal region : Biotin
SKU
AVIARP55775_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1orf110

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LKVICLYHVKLLTWEQRQLQKELQRLQQAETMKKKFSSYLGNGFQKRPED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: coiled-coil domain-containing protein 190

Protein Size: 302

Purification: Affinity Purified
More Information
SKU AVIARP55775_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55775_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339512
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×