CCDC197 Antibody - N-terminal region : Biotin

CCDC197 Antibody - N-terminal region : Biotin
SKU
AVIARP55545_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf48

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: uncharacterized protein CCDC197; putative uncharacterized protein CCDC197

Protein Size: 140

Purification: Affinity Purified
More Information
SKU AVIARP55545_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55545_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 256369
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×