CCDC46 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCDC46

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Centrosomal protein of 112 kDa

Protein Size: 211

Purification: Affinity Purified

• SKU: AVIARP53824_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53824_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 201134
• Host: Rabbit
• Conjugate: Conjugated, HRP