CD83 Antibody

Uniprot: Q01151

Gene Name: CD83

Immunogen: Recombinant human CD83

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 56%

Core Sequence: PEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQ

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 56%, Pig - 62%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83

Protein name: CD83 molecule

CD Antigen: CD83

Product panel: CD Antigen

Clone No.: K70018_3H11

Antigen Species: Human

Target Name: CD83

IHC Verification: -

IHC Dilution: N/A

WB Verification: -

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-1201

Cross reactivity: Not tested

• SKU: ASBKC-2909-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: KC-2909-100
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: ELISA
• Isotype: IgG1
• Human Gene ID: 9308
• Host: Mouse
• Conjugate: Unconjugated