CDK19 Antibody - C-terminal region : HRP

CDK19 Antibody - C-terminal region : HRP
SKU
AVIARP55155_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that is one of the components of the Mediator coactivator complex. The Mediator complex is a multiprotein complex required for transcriptional activation by DNA binding transcription factors of genes transcribed by RNA polymerase II. The protein encoded by this gene is similar to cyclin-dependent kinase 8 which can also be a component of the Mediator complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDK19

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDDP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cyclin-dependent kinase 19

Protein Size: 442

Purification: Affinity Purified
More Information
SKU AVIARP55155_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55155_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23097
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×