CDK5RAP1 Antibody - N-terminal region : HRP

CDK5RAP1 Antibody - N-terminal region : HRP
SKU
AVIARP56906_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDK5RAP1

Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: CDK5 regulatory subunit-associated protein 1

Protein Size: 497

Purification: Affinity Purified

Subunit: -associated protein 1
More Information
SKU AVIARP56906_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56906_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51654
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×