CDKN3 Antibody - C-terminal region : FITC

CDKN3 Antibody - C-terminal region : FITC
SKU
AVIARP53629_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: CDKN3 belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDKN3

Key Reference: Okamoto,K., (2006) Biochem. Biophys. Res. Commun. 351 (1), 216-222

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cyclin-dependent kinase inhibitor 3

Protein Size: 212

Purification: Affinity Purified
More Information
SKU AVIARP53629_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53629_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1033
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×