CFP Antibody - N-terminal region : HRP

CFP Antibody - N-terminal region : HRP
SKU
AVIARP56381_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: CFP is a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedbac

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CFP

Key Reference: Bathum,L., (2006) Mol. Immunol. 43 (5), 473-479

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: QYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Properdin

Protein Size: 469

Purification: Affinity Purified
More Information
SKU AVIARP56381_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56381_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5199
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×