Chodl Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Chodl is a single-pass type I membrane protein. The function of Chodl remians unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: YLYQWNDDRCNMKHNYICKYEPEIHPTEPAEKPYLTNQPEETHENVVVTE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chondrolectin

Protein Size: 273

Purification: Affinity Purified

• SKU: AVIARP53781_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53781_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 246048
• Host: Rabbit
• Conjugate: Conjugated, Biotin