CHODL Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHODL

Key Reference: N/A

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: VSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Chondrolectin

Protein Size: 232

Purification: Affinity purified

• SKU: AVIARP53780_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53780_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 140578
• Host: Rabbit
• Conjugate: Conjugated, HRP