CHTF18 Antibody - middle region : Biotin

CHTF18 Antibody - middle region : Biotin
SKU
AVIARP57589_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CHTF18, CHTF8 (MIM 613202), and DCC1 (DSCC1; MIM 613203) are components of an alternative replication factor C (RFC) (see MIM 600404) complex that loads PCNA (MIM 176740) onto DNA during S phase of the cell cycle (Merkle et al., 2003 [PubMed 12766176]; Bermudez et al., 2003 [PubMed 12930902]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHTF18

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Chromosome transmission fidelity protein 18 homolog

Protein Size: 975

Purification: Affinity Purified
More Information
SKU AVIARP57589_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57589_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 63922
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×