CLPB Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLPB

Key Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Caseinolytic peptidase B protein homolog

Protein Size: 707

Purification: Affinity Purified

• SKU: AVIARP53790_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53790_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 81570
• Host: Rabbit
• Conjugate: Conjugated, HRP