COG6 Antibody - C-terminal region : FITC

COG6 Antibody - C-terminal region : FITC
SKU
AVIARP57442_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Alternative splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human COG6

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: ADMATFMVNSLYMMKTTLALFEFTDRRLEMLQFQIEAHLDTLINEQASYV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Conserved oligomeric Golgi complex subunit 6

Protein Size: 615

Purification: Affinity Purified
More Information
SKU AVIARP57442_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57442_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57511
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×