COPG2 Antibody - N-terminal region : FITC

COPG2 Antibody - N-terminal region : FITC
SKU
AVIARP54845_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coa

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COPG2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coatomer subunit gamma-2

Protein Size: 871

Purification: Affinity Purified

Subunit: gamma-2
More Information
SKU AVIARP54845_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54845_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26958
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×