COTL1 Antibody - N-terminal region : Biotin

COTL1 Antibody - N-terminal region : Biotin
SKU
AVIARP55374_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COTL1

Key Reference: Dai,H., (2006) Biochim. Biophys. Acta 1764 (11), 1688-1700

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Coactosin-like protein

Protein Size: 142

Purification: Affinity Purified
More Information
SKU AVIARP55374_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55374_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23406
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×