CPA6 Antibody - middle region : FITC

CPA6 Antibody - middle region : FITC
SKU
AVIARP57397_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the family of carboxypeptidases, which catalyze the release of C-terminal amino acid, and have functions ranging from digestion of food to selective biosynthesis of neuroendocrine peptides. Polymorphic variants and a reciprocal translocation t(6;8)(q26;q13) involving this gene, have been associated with Duane retraction syndrome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPA6

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carboxypeptidase A6

Protein Size: 437

Purification: Affinity Purified
More Information
SKU AVIARP57397_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57397_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57094
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×