CRAT Antibody - N-terminal region : FITC

CRAT Antibody - N-terminal region : FITC
SKU
AVIARP53559_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Carnitine acetyltransferase (CRAT) is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Different subcellular localizations of the CRAT mRNAs are thought to result from alternative splicing of the CRAT gene suggested by the divergent sequences in the 5' region of peroxisomal and mitochondrial CRAT cDNAs and the location of an intron where the sequences diverge.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRAT

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: MKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carnitine O-acetyltransferase

Protein Size: 467

Purification: Affinity Purified
More Information
SKU AVIARP53559_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53559_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1384
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×