Cyb5r2 Antibody - C-terminal region : FITC

Cyb5r2 Antibody - C-terminal region : FITC
SKU
AVIARP53714_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Cyb5r2 is responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: WEYSSGFITADMIKEHLPPPGEATLILVCGPPPLIQEAAHPSLEQLGYTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-cytochrome b5 reductase 2

Protein Size: 276

Purification: Affinity Purified
More Information
SKU AVIARP53714_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53714_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 365345
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×