CYP27C1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP27C1

Key Reference: Nelson,D.R., (2004) Pharmacogenetics 14 (1), 1-18

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 27C1

Protein Size: 372

Purification: Affinity Purified

• SKU: AVIARP54373_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54373_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 339761
• Host: Rabbit
• Conjugate: Conjugated, FITC