CYP27C1 Antibody - middle region : HRP

CYP27C1 Antibody - middle region : HRP
SKU
AVIARP54373_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because transcript sequence consistent with the reference genome assembly was not available for all regions of the RefSeq transcript. The extent of this transcript is supported by transcript alignments.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP27C1

Key Reference: Nelson,D.R., (2004) Pharmacogenetics 14 (1), 1-18

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cytochrome P450 27C1

Protein Size: 372

Purification: Affinity Purified
More Information
SKU AVIARP54373_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54373_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 339761
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×