CYP4V2 Antibody - middle region : Biotin

CYP4V2 Antibody - middle region : Biotin
SKU
AVIARP55993_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: CYP4V2 may have a role in fatty acid and steroid metabolism.This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP4V2

Key Reference: Bezemer,I.D., (2008) JAMA 299 (11), 1306-1314

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome P450 4V2

Protein Size: 525

Purification: Affinity Purified
More Information
SKU AVIARP55993_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55993_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 285440
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×