DAPK1 Antibody - N-terminal region : FITC

DAPK1 Antibody - N-terminal region : FITC
SKU
AVIARP58219_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consen

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAPK1

Molecular Weight: 157kDa

Peptide Sequence: Synthetic peptide located within the following region: MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Death-associated protein kinase 1

Protein Size: 1431

Purification: Affinity Purified
More Information
SKU AVIARP58219_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58219_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 1612
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×