DAPP1 Antibody - middle region : HRP

DAPP1 Antibody - middle region : HRP
SKU
AVIARP55042_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DAPP1

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: KHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide

Protein Size: 280

Purification: Affinity Purified
More Information
SKU AVIARP55042_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55042_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27071
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×