DENND1A Antibody - N-terminal region : HRP

DENND1A Antibody - N-terminal region : HRP
SKU
AVIARP57501_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1A

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DENN domain-containing protein 1A

Protein Size: 1009

Purification: Affinity Purified
More Information
SKU AVIARP57501_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57501_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57706
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×