DENND2C Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of DENND2C is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DENND2C

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: DIFESKRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DENN domain-containing protein 2C

Protein Size: 871

Purification: Affinity Purified

• SKU: AVIARP53471_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53471_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 163259
• Host: Rabbit
• Conjugate: Conjugated, FITC