Dkk2 Antibody - middle region : Biotin

Dkk2 Antibody - middle region : Biotin
SKU
AVIARP55047_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Dkk2 antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer's disease.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: NGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHSKMP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Dickkopf-related protein 2

Protein Size: 259

Purification: Affinity Purified
More Information
SKU AVIARP55047_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55047_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56811
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×