EDDM3B Antibody - middle region : FITC

EDDM3B Antibody - middle region : FITC
SKU
AVIARP53756_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells.

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: ISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESRSF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epididymal secretory protein E3-beta

Protein Size: 147

Purification: Affinity Purified
More Information
SKU AVIARP53756_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53756_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 64184
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×