EFHA2 Antibody - N-terminal region : Biotin

EFHA2 Antibody - N-terminal region : Biotin
SKU
AVIARP55802_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EFHA2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: EF-hand domain-containing family member A2

Protein Size: 530

Purification: Affinity Purified
More Information
SKU AVIARP55802_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55802_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286097
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×