EFHC1 Antibody - N-terminal region : HRP

EFHC1 Antibody - N-terminal region : HRP
SKU
AVIARP53729_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes an EF-hand-containing calcium binding protein. The encoded protein likely plays a role in calcium homeostasis. Mutations in this gene have been associated with susceptibility to juvenile myoclonic epilepsy and juvenile absence epilepsy. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human EFHC1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DTVEIREVHERNDGRDPFPLLMNRQRVPKVLVENAKNFPQCVLEISDQEV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: EF-hand domain-containing protein 1

Protein Size: 550

Purification: Affinity Purified
More Information
SKU AVIARP53729_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53729_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 114327
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×