EIF5A2 Antibody - N-terminal region : FITC

EIF5A2 Antibody - N-terminal region : FITC
SKU
AVIARP57402_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EIF5A2 is a mRNA-binding protein involved in translation elongation. EIF5A2 has an important function at the level of mRNA turnover, probably acting downstream of decapping.EIF5A2 is involved in actin dynamics and cell cycle progression, mRNA decay and probably in a pathway involved in stress response and maintenance of cell wall integrity. EIF5A2 functions as a regulator of apoptosis.EIF5A2 mediates effects of polyamines on neuronal process extension and survival.EIF5A2 may play an important role in brain development and function, and in skeletal muscle stem cell differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF5A2

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 5A-2

Protein Size: 153

Purification: Affinity Purified
More Information
SKU AVIARP57402_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57402_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 56648
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×