Elf2 Antibody - middle region : Biotin

Elf2 Antibody - middle region : Biotin
SKU
AVIARP57859_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Elf2

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNKPDMNYETMGRALRYYY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E74-like factor 2 EMBL AAH83598.1

Protein Size: 519

Purification: Affinity Purified
More Information
SKU AVIARP57859_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57859_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 361944
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×