ELP2 Antibody - middle region : FITC

ELP2 Antibody - middle region : FITC
SKU
AVIARP57179_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ELP2 regulates the ligand-dependent activation of STAT3. ELP2 acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ELP2

Molecular Weight: 92kDa

Peptide Sequence: Synthetic peptide located within the following region: EESGVWLEQVRVGEVGGNTLGFYDCQFNEDGSMIIAHAFHGALHLWKQNT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Elongator complex protein 2

Protein Size: 826

Purification: Affinity Purified
More Information
SKU AVIARP57179_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57179_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55250
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×