ENOSF1 Antibody - N-terminal region : HRP

ENOSF1 Antibody - N-terminal region : HRP
SKU
AVIARP56963_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1

Key Reference: Giusti,B., (er) Biochem. Genet. (2008) In press

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial enolase superfamily member 1

Protein Size: 443

Purification: Affinity Purified
More Information
SKU AVIARP56963_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56963_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55556
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×