ENSA Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENSA

Molecular Weight: 12

Peptide Sequence: Synthetic peptide located within the following region: MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-endosulfine

Protein Size: 113

Purification: Affinity Purified

• SKU: AVIARP53514_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53514_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2029
• Host: Rabbit
• Conjugate: Conjugated, Biotin