ERAS Antibody - middle region : FITC

ERAS Antibody - middle region : FITC
SKU
AVIARP55794_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERAS

Key Reference: Miyamoto,S., (2008) Carcinogenesis 29 (2), 418-426

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: GTPase ERas

Protein Size: 233

Purification: Affinity Purified
More Information
SKU AVIARP55794_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55794_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3266
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×