ERCC4 Antibody - middle region : HRP

ERCC4 Antibody - middle region : HRP
SKU
AVIARP58272_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene forms a complex with ERCC1 and is involved in the 5' incision made during nucleotide excision repair. This complex is a structure specific DNA repair endonuclease that interacts with EME1. Defects in this gene are a cause

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERCC4

Molecular Weight: 101kDa

Peptide Sequence: Synthetic peptide located within the following region: FLLRLYRKTFEKDSKAEEVWMKFRKEDSSKRIRKSHKRPKDPQNKERAST

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA repair endonuclease XPF

Protein Size: 916

Purification: Affinity Purified
More Information
SKU AVIARP58272_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58272_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2072
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×