ERCC5 Antibody - N-terminal region : Biotin

ERCC5 Antibody - N-terminal region : Biotin
SKU
AVIARP54287_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Excision repair cross-complementing rodent repair deficiency, complementation group 5 (xeroderma pigmentosum, complementation group G) is involved in excision repair of UV-induced DNA damage. Mutations cause Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Multiple alternatively spliced transcript variants encoding distinct isoforms have been described, but the biological validity of all variants has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ERCC5

Key Reference: Sasaki,M., (2008) Neoplasia 10 (3), 255-265

Molecular Weight: 133kDa

Peptide Sequence: Synthetic peptide located within the following region: NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA repair protein complementing XP-G cells

Protein Size: 1186

Purification: Affinity Purified
More Information
SKU AVIARP54287_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54287_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2073
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×