ERCC5 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a single-strand specific DNA endonuclease that makes the 3' incision in DNA excision repair following UV-induced damage. The protein may also function in other cellular processes, including RNA polymerase II transcription, and transcription-coupled DNA repair. Mutations in this gene cause xeroderma pigmentosum complementation group G (XP-G), which is also referred to as xeroderma pigmentosum VII (XP7), a skin disorder characterized by hypersensitivity to UV light and increased susceptibility for skin cancer development following UV exposure. Some patients also develop Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Read-through transcription exists between this gene and the neighboring upstream BIVM (basic, immunoglobulin-like variable motif containing) gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ERCC5

Molecular Weight: 130kDa

Peptide Sequence: Synthetic peptide located within the following region: HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA repair protein complementing XP-G cells

Protein Size: 1180

Purification: Affinity Purified

• SKU: AVIARP54288_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54288_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2073
• Host: Rabbit
• Conjugate: Conjugated, FITC