ETFB Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ETFB

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: PQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Electron transfer flavoprotein subunit beta

Protein Size: 255

Purification: Affinity Purified

• SKU: AVIARP54441_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54441_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 2109
• Host: Rabbit
• Conjugate: Conjugated, HRP