Etv3l Antibody - middle region : Biotin

Etv3l Antibody - middle region : Biotin
SKU
AVIARP57970_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Etv3l

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: HVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Etv3l protein EMBL AAI27526.1

Protein Size: 207

Purification: Affinity Purified
More Information
SKU AVIARP57970_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57970_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 499651
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×