EVX1 Antibody - N-terminal region : Biotin

EVX1 Antibody - N-terminal region : Biotin
SKU
AVIARP57971_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: EVX1 is a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The protein may play an important role as a transcriptional repressor during embryogenesis.This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EVX1

Key Reference: Briata,P., (1995) J. Biol. Chem. 270 (46), 27695-27701

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: PEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGSAAGPGAEPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox even-skipped homolog protein 1

Protein Size: 407

Purification: Affinity Purified
More Information
SKU AVIARP57971_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57971_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 2128
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×