FAM13C1 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM13C

Protein Size: 487

Purification: Affinity Purified

• SKU: AVIARP54376_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54376_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 220965
• Host: Rabbit
• Conjugate: Conjugated, HRP