FAM173B Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of LOC134145 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC134145

Key Reference: Lanfranchi,G., (1996) Genome Res. 6 (1), 35-42

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: EGGGGIPLETLKEESQSRHVLPASFEVNSLQKSNWGFLLTGLVGGTLVAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein FAM173B

Protein Size: 233

Purification: Affinity Purified

• SKU: AVIARP53473_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53473_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 134145
• Host: Rabbit
• Conjugate: Conjugated, FITC