FAM29A Antibody - middle region : HRP

FAM29A Antibody - middle region : HRP
SKU
AVIARP56990_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM29A

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: HAUS augmin-like complex subunit 6

Protein Size: 955

Purification: Affinity Purified

Subunit: 6
More Information
SKU AVIARP56990_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56990_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54801
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×