FAM36A Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAM36A is a multi-pass membrane protein. It belongs to the FAM36 family. The exact function of FAM36A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM36A

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome c oxidase protein 20 homolog

Protein Size: 118

Purification: Affinity Purified

• SKU: AVIARP53455_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53455_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 116228
• Host: Rabbit
• Conjugate: Conjugated, FITC