FAM78A Antibody - N-terminal region : HRP

FAM78A Antibody - N-terminal region : HRP
SKU
AVIARP55410_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of FAM78A remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM78A

Key Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein FAM78A

Protein Size: 283

Purification: Affinity Purified
More Information
SKU AVIARP55410_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55410_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 286336
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×